Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405412

Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OAT3, OCT3, Oat3, Roct
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405412
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC22A8 antibody: synthetic peptide directed towards the middle region of human SLC22A8
Sequence PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPL QPHGPGLGSS
Predicted Reactivity Human : 100%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against SLC22A8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC22A8
Background SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.
Molecular Weight 60kDa
Gene ID 9376
NCBI Accession NP_004245, NM_004254
UniProt Q8TCC7
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC22A8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Windass, Lowes, Wang et al.: "The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin." in: The Journal of pharmacology and experimental therapeutics, Vol. 322, Issue 3, pp. 1221-7, 2007 (PubMed).

Alternatives for antigen "Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8)", type "Antibodies"
Hosts (31), (2)
Reactivities (27), (24), (18), (1)
Applications (22), (13), (13), (10), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1), (1)
Beacon