ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2) (N-Term) antibody

Details for Product No. ABIN405464
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
8430408C20Rik, AI385560, ATP6a2, AW489264, Atp6n1d, Atp6n2, C76904, ISF, J6B7, SHIF, Stv1, TJ6M, TJ6s, Tj6, V-ATPase 116 kDa, V-ATPase a2, A2, ARCL, ARCL2A, ATP6A2, ATP6N1D, RTF, STV1, TJ6, TJ6S, VPH1 ... show more
8430408C20Rik, AI385560, ATP6a2, AW489264, Atp6n1d, Atp6n2, C76904, ISF, J6B7, SHIF, Stv1, TJ6M, TJ6s, Tj6, V-ATPase 116 kDa, V-ATPase a2, A2, ARCL, ARCL2A, ATP6A2, ATP6N1D, RTF, STV1, TJ6, TJ6S, VPH1, WSS, Cc1-3, J6b7, atp6v0a2, si:ch211-199i18.4 show less
Epitope
N-Term
(1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(7)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(7), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405464
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ATP6V0A2
Sequence INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREV TKNKEKLRKN
Predicted Reactivity Human : 100 %, Rat : 100 %, Dog : 90 %, Horse : 90 %, Pig : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against ATP6V0A2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATP6V0A2
Background The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain, ATP6V0A2 is a component of the V(0) domain.The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells. H(+)-ATPases are comprised of a peripheral V(1) domain and an integral membrane V(0) domain, ATP6V0A2 is a component of the V(0) domain (Smith et al., 2003 [PubMed 14580332]).
Molecular Weight 98 kDa
Gene ID 23545
NCBI Accession NM_012463, NP_036595
UniProt Q9Y487
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 856 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2) (N-Term) antibody anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2) (N-Term) antibody
anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2) (N-Term) antibody (2) anti-ATPase, H+ Transporting, Lysosomal V0 Subunit A2 (ATP6V0A2) (N-Term) antibody (Image 2)
Background publications Kornak, Reynders, Dimopoulou et al.: "Impaired glycosylation and cutis laxa caused by mutations in the vesicular H+-ATPase subunit ATP6V0A2." in: Nature genetics, Vol. 40, Issue 1, pp. 32-4, 2007 (PubMed).

Hosts (7), (1)
Reactivities (7)
Applications (7), (2), (2), (2), (1)
Epitopes (1), (1), (1), (1)
back to top