Ring Finger Protein 133 (RNF133) (N-Term) antibody

Details for Product No. ABIN405559
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Greul2
Epitope
N-Term
(4), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(28), (15), (15)
Host
Rabbit
(24), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (8), (4), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405559
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human RNF133
Sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVI VPPEGKIQNA
Predicted Reactivity Horse : 100 %, Dog : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against RNF133. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RNF133
Background RNF133 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene has no intron.
Molecular Weight 42 kDa
Gene ID 168433
NCBI Accession NM_139175, NP_631914
UniProt Q8WVZ7
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 376 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).

Hosts (24), (5)
Reactivities (28), (15), (15)
Applications (19), (10), (8), (4), (3), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1), (1), (1)
back to top