Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405559

Ring Finger Protein 133 (RNF133) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Greul2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405559
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RNF133 antibody: synthetic peptide directed towards the N terminal of human RNF133
Sequence VVWMAYMNISFHVGNHVLSELGETGVFGRSSTLKRVAGVI VPPEGKIQNA
Predicted Reactivity Horse : 100%, Dog : 92%, Rabbit : 92%
Characteristics This is a rabbit polyclonal antibody against RNF133. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RNF133
Background RNF133 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene has no intron.
Molecular Weight 42kDa
Gene ID 168433
NCBI Accession NP_631914, NM_139175
UniProt Q8WVZ7
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RNF133 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Saurin, Borden, Boddy et al.: "Does this have a familiar RING?" in: Trends in biochemical sciences, Vol. 21, Issue 6, pp. 208-14, 1996 (PubMed).

Alternatives for antigen "Ring Finger Protein 133 (RNF133)", type "Antibodies"
Hosts (21), (4)
Reactivities (24), (14), (14)
Applications (16), (10), (9), (3), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1), (1), (1), (1)
Beacon