Tripartite Motif Containing 55 (TRIM55) (Middle Region) antibody

Details for Product No. ABIN405566
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms trim55, zgc:92123, wu:fb71c01, MURF-2, RNF29, muRF2, D830041C10Rik, Murf2, Rnf29, TRIM55
Epitope
Middle Region
(4), (4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(14), (5), (4), (3), (3), (2), (2), (2), (2)
Host
Rabbit
(12), (4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (5), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405566
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIM55
Sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQE STRPEKKSDQ
Specificity 100 % homologous to all four isoforms of TRIM55.
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against TRIM55. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM55
Background TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
Molecular Weight 27 kDa
Gene ID 84675
NCBI Accession NM_184087, NP_908975
UniProt Q9BYV6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 241 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 55 (TRIM55) (Middle Region) antibody WB Suggested Anti-TRIM55 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Background publications Lange, Xiang, Yakovenko et al.: "The kinase domain of titin controls muscle gene expression and protein turnover." in: Science (New York, N.Y.), Vol. 308, Issue 5728, pp. 1599-603, 2005 (PubMed).

Hosts (12), (4), (2)
Reactivities (14), (5), (4), (3), (3), (2), (2), (2), (2)
Applications (15), (5), (3), (2), (1)
Epitopes (4), (4), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top