Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4) antibody

Antigen: Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4)

Synonyms: ADH-2, Adh3, Adh4, Adh-3, Adt-1, Adh-3e, Adh-3t, Adh3-e, Adh3-t, AI325182, Adh2, ADH-1, Ac1002

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN405577

Additional Information

Alternative name: Alcohol dehydrogenase 4 (ADH4)

Gene ID: ADH4

UniProt: P08319

Immunogen: The immunogen for anti-ADH4 antibody: synthetic peptide directed towards the middle region of human ADH4

Sequence: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFF GTSTFSQYTV

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ADH4 antibody concentration is 1 mg/ml.

Description: ADH4, class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene encodes class II alcohol dehydrogenase 4 pi subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class II alcohol dehydrogenase is a homodimer composed of 2 pi subunits. It exhibits a high activity for oxidation of long-chain aliphatic alcohols and aromatic alcohols and is less sensitive to pyrazole. This gene is localized to chromosome 4 in the cluster of alcohol dehydrogenase genes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 380 amino acids

Molecular Weight: 40kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4) antibody

anti-Alcohol Dehydrogenase 4 (Class II), pi Polypeptide (ADH4) antibody (Image 2)

Publications

Product: Kuo, Kalsi, Prescott et al.: "Association of ADH and ALDH genes with alcohol dependence in the Irish Affected Sib Pair Study of alcohol dependence (IASPSAD) sample." in: Alcoholism, clinical and experimental research, Vol. 32, Issue 5, pp. 785-95, 2008 (PubMed).

Kuo, Yu, Petrovich et al.: "The CyberKnife stereotactic radiosurgery system: description, installation, and an initial evaluation of use and functionality." in: Neurosurgery, Vol. 62 Suppl 2, pp. 785-9, 2008 (PubMed).