Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405674

Neuregulin 3 (NRG3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HRG3, pro-NRG3, ska, RGD1559678, NRG3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN405674
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NRG3 antibody: synthetic peptide directed towards the middle region of human NRG3
Sequence TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPS VGLEETCLQM
Predicted Reactivity Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 92%, Horse : 92%, Pig : 92%, Chicken : 91%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against NRG3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NRG3
Background Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.
Molecular Weight 75kDa
Gene ID 10718
NCBI Accession NP_001010848, NM_001010848
UniProt P56975-4
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NRG3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Neuregulin 3 (NRG3)", type "Antibodies"
Hosts (24), (8)
Reactivities (25), (16), (14), (14), (12), (12)
Applications (16), (15), (10), (10), (5), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1), (1)
Beacon