Did you know that you can buy products from over 140 different suppliers from us?

Neuregulin 3 (NRG3) (Middle Region) antibody

Details for Product No. ABIN405674
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HRG3, pro-NRG3, ska, RGD1559678, NRG3
Epitope
Middle Region
(7), (4), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Chicken
(33), (17), (14), (14), (12), (12)
Host
Rabbit
(31), (7), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(20), (18), (12), (11), (10), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405674
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NRG3
Sequence TSINMQLPSRETNPYFNSLEQKDLVGYSSTRASSVPIIPS VGLEETCLQM
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Guinea pig : 90 %, Horse : 90 %, Pig : 90 %, Chicken : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against NRG3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NRG3
Background Neuregulins are a family of growth and differentiation factors that are related to epidermal growth factor.
Molecular Weight 75 kDa
Gene ID 10718
NCBI Accession NM_001010848, NP_001010848
UniProt P56975-4
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 696 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Neuregulin 3 (NRG3) (Middle Region) antibody WB Suggested Anti-NRG3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
anti-Neuregulin 3 (NRG3) (Middle Region) antibody (2) anti-Neuregulin 3 (NRG3) (Middle Region) antibody (Image 2)
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Hosts (31), (7), (1)
Reactivities (33), (17), (14), (14), (12), (12)
Applications (20), (18), (12), (11), (10), (2), (2), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405674
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top