Did you know that you can buy products from over 140 different suppliers from us?

Synaptogyrin 4 (SYNGR4) (N-Term) antibody

Details for Product No. ABIN405863
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700016O14Rik
Epitope
N-Term
(12)
Reactivity
Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(30), (21), (21)
Host
Rabbit
(26), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (17), (10), (6), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405863
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SYNGR4
Sequence MHIPKSLQELANSEAVQFLRRPKTITRVFEGVFSLIVFSS LLTDGYQNKM
Predicted Reactivity Dog : 85 %, Rabbit : 85 %, Rat : 75 %
Characteristics This is a rabbit polyclonal antibody against SYNGR4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SYNGR4
Background SYNGR4 is an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.This gene encodes an integral membrane protein. The gene belongs to the synaptogyrin gene family. Like other members of the family the protein contains four transmembrane regions. The exact function of this protein is unclear.
Molecular Weight 26 kDa
Gene ID 23546
NCBI Accession NM_012451, NP_036583
UniProt O95473
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 234 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Synaptogyrin 4 (SYNGR4) (N-Term) antibody WB Suggested Anti-SYNGR4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Smith, Tachibana, Pohl et al.: "A transcript map of the chromosome 19q-arm glioma tumor suppressor region." in: Genomics, Vol. 64, Issue 1, pp. 44-50, 2000 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405863
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top