Did you know that you can buy products from over 140 different suppliers from us?

Alanine-Glyoxylate Aminotransferase 2-Like 2 (AGXT2L2) (N-Term) antibody

Details for Product No. ABIN405941
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AGXT2L2, PHLU, Agxt2l2, 2900006B13Rik
Epitope
N-Term
(5), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(34), (24), (24), (2), (1)
Host
Rabbit
(32), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (12), (10), (9), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405941
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human AGXT2L2
Sequence QNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSG SEANDLALRL
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against AGXT2L2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name AGXT2L2
Background The function remains unknown.
Molecular Weight 50 kDa
Gene ID 85007
NCBI Accession NM_153373, NP_699204
UniProt Q8IUZ5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 450 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Validation Images
back to top