Chromosome 19 Open Reading Frame 47 (C19orf47) (Middle Region) antibody

Details for Product No. ABIN405994
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MGC79696
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(16), (13), (12), (12), (12), (12)
Host
Rabbit
(17), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (9), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN405994
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C19orf47
Sequence YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETK ADTTTGSKPT
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Rabbit : 100 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against C19orf47. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C19orf47
Background The function of the C19orf47 protein remains unknown.
Molecular Weight 38 kDa
Gene ID 126526
NCBI Accession NM_178830, NP_849152
UniProt Q8N9M1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 355 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (17), (1)
Reactivities (16), (13), (12), (12), (12), (12)
Applications (10), (9), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top