Protocadherin alpha Subfamily C, 2 (PCDHAC2) (N-Term) antibody

Details for Product No. ABIN406044
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCDH-ALPHA-C2, CNRc2, rCNRvc2, CNRC02, PCHD
Epitope
N-Term
(2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(27), (17), (17), (17), (17), (17)
Host
Rabbit
(23), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (14), (10), (7), (5), (3), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406044
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PCDHAC2
Sequence SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELR YSLSSYTSDR
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against PCDHAC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PCDHAC2
Background PCDHAC2 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
Molecular Weight 105 kDa
Gene ID 56134
NCBI Accession NM_018899, NP_061722
UniProt Q9Y5I4
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1007 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protocadherin alpha Subfamily C, 2 (PCDHAC2) (N-Term) antibody WB Suggested Anti-PCDHAC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Wu, Zhang, Cheng et al.: "Comparative DNA sequence analysis of mouse and human protocadherin gene clusters." in: Genome research, Vol. 11, Issue 3, pp. 389-404, 2001 (PubMed).

Hosts (23), (5)
Reactivities (27), (17), (17), (17), (17), (17)
Applications (17), (14), (10), (7), (5), (3), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top