Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406053

Immunoglobulin Superfamily, Member 9 (IGSF9) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NRT1, Dasm1, Ncaml, 644ETD8, mKIAA1355, Kiaa1355-hp, FP18798, IGSF9A, Nrt1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406053
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IGSF9 antibody: synthetic peptide directed towards the N terminal of human IGSF9
Sequence SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFL DQHIPEDDFA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Guinea pig : 92%, Mouse : 92%, Rabbit : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against IGSF9. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IGSF9
Background IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.
Molecular Weight 125kDa
Gene ID 57549
NCBI Accession NP_065840, NM_020789
UniProt Q9P2J2
Research Area Neurology, Neurogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IGSF9 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Alternatives for antigen "Immunoglobulin Superfamily, Member 9 (IGSF9)", type "Antibodies"
Hosts (19)
Reactivities (18), (17), (17), (17), (17), (17), (17)
Applications (15), (10), (5), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon