Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406096

FLJ23356 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
Rabbit
Clonality Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406096
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ23356 antibody: synthetic peptide directed towards the N terminal of human FLJ23356
Sequence CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSL EMKDDFLHGL
Predicted Reactivity Human :100%,   Mouse :100%,   Crab-eating macaque :100%,   Bovine :92%,   Rat :92%,   Chicken :85%,   African clawed frog :85%,  
Characteristics This is a rabbit polyclonal antibody against FLJ23356. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background The exact function of FLJ23356 remains unknown.
Molecular Weight 40kDa
Gene ID 84197
NCBI Accession NP_115613, NM_032237
UniProt Q9H5K3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ23356 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

Beacon