FLJ23356 (N-Term) antibody

Details for Product No. ABIN406096
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
Rabbit
Clonality
Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406096
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FLJ23356
Sequence CEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSL EMKDDFLHGL
Predicted Reactivity Human :100 %,   Mouse :100 %,   Crab-eating macaque :100 %,   Bovine :90 %,   Rat :90 %,   Chicken :80 %,   African clawed frog :80 %,  
Characteristics This is a rabbit polyclonal antibody against FLJ23356. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The exact function of FLJ23356 remains unknown.
Molecular Weight 40 kDa
Gene ID 84197
NCBI Accession NM_032237, NP_115613
UniProt Q9H5K3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 350 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-FLJ23356 (N-Term) antibody WB Suggested Anti-FLJ23356 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
Background publications Barrios-Rodiles, Brown, Ozdamar et al.: "High-throughput mapping of a dynamic signaling network in mammalian cells." in: Science (New York, N.Y.), Vol. 307, Issue 5715, pp. 1621-5, 2005 (PubMed).

back to top