Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406164

Chromosome 10 Open Reading Frame 33 (C10ORF33) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C10orf33, FP3420, C26H10orf33, 3830409H07Rik, 4833409A17Rik, RGD1303232, DKFZp469H0233
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406164
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C10orf33 antibody: synthetic peptide directed towards the N terminal of human C10orf33
Sequence MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVI GAGHNGLVAA
Predicted Reactivity Human :100%,   Sumatran orangutan :78%,  
Characteristics This is a rabbit polyclonal antibody against C10orf33. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C10orf33
Background The exact function of C10orf33 remains unknown.
Molecular Weight 63kDa
Gene ID 84795
NCBI Accession NP_116098, NM_032709
UniProt Q8N2H3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C10orf33 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Chromosome 10 Open Reading Frame 33 (C10ORF33)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (1)
Epitopes (2), (1), (1), (1)
Beacon