Chromosome 20 Open Reading Frame 160 (C20orf160) (N-Term) antibody

Details for Product No. ABIN406221
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C20orf160, dJ310O13.5, C20H20orf160
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(14), (12), (12), (12), (12), (12)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406221
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C20orf160
Sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSI LSLSARCLLL
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Rabbit : 100 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against C20orf160. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C20orf160
Background The specific function of C20orf160 is not yet known.
Molecular Weight 47 kDa
Gene ID 140706
NCBI Accession NM_080625, NP_542192
UniProt Q9NUG4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 20 Open Reading Frame 160 (C20orf160) (N-Term) antibody WB Suggested Anti-C20orf160 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Validation Images
back to top