Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406288

OCIA Domain Containing 2 (OCIAD2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1810027I20Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406288
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OCIAD2 antibody: synthetic peptide directed towards the middle region of human OCIAD2
Sequence QGYLAANSRFGSLPKVALAGLLGFGLGKVSYIGVCQSKFH FFEDQLRGAG
Predicted Reactivity Rabbit : 92%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against OCIAD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OCIAD2
Background The exact function of OCIAD2 is not known.
Molecular Weight 17kDa
Gene ID 132299
NCBI Accession NP_001014446, NM_001014446
UniProt Q56VL3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OCIAD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "OCIA Domain Containing 2 (OCIAD2)", type "Antibodies"
Hosts (34)
Reactivities (32), (22), (20), (12), (12), (12)
Applications (25), (22), (18), (10), (9), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (8), (1)
Beacon