Fibrous Sheath Interacting Protein 1 (FSIP1) (Middle Region) antibody

Details for Product No. ABIN406304
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1700012M13Rik, 4933432K11Rik
Epitope
Middle Region
(1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(19), (15), (12), (12), (12)
Host
Rabbit
(21), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (9), (6), (5), (5), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406304
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FSIP1
Sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIK LQELSAASPT
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 90 %, Guinea pig : 90 %, Horse : 90 %, Pig : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against FSIP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FSIP1
Background The exact functions of FSIP1 remain unknown.
Molecular Weight 66 kDa
Gene ID 161835
NCBI Accession NM_152597, NP_689810
UniProt Q8NA03
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 581 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fibrous Sheath Interacting Protein 1 (FSIP1) (Middle Region) antibody WB Suggested Anti-FSIP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysate
Background publications Brown, Miki, Harper et al.: "A-kinase anchoring protein 4 binding proteins in the fibrous sheath of the sperm flagellum." in: Biology of reproduction, Vol. 68, Issue 6, pp. 2241-8, 2003 (PubMed).

Hosts (21), (1)
Reactivities (19), (15), (12), (12), (12)
Applications (13), (10), (9), (6), (5), (5), (2), (2), (1), (1)
Conjugates (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
back to top