Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406304

Fibrous Sheath Interacting Protein 1 (FSIP1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700012M13Rik, 4933432K11Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406304
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FSIP1 antibody: synthetic peptide directed towards the middle region of human FSIP1
Sequence DEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIK LQELSAASPT
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%, Bovine : 92%, Dog : 92%, Guinea pig : 92%, Horse : 92%, Pig : 85%, Rabbit : 84%
Characteristics This is a rabbit polyclonal antibody against FSIP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FSIP1
Background The exact functions of FSIP1 remain unknown.
Molecular Weight 66kDa
Gene ID 161835
NCBI Accession NP_689810, NM_152597
UniProt Q8NA03
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FSIP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brown, Miki, Harper et al.: "A-kinase anchoring protein 4 binding proteins in the fibrous sheath of the sperm flagellum." in: Biology of reproduction, Vol. 68, Issue 6, pp. 2241-8, 2003 (PubMed).

Alternatives for antigen "Fibrous Sheath Interacting Protein 1 (FSIP1)", type "Antibodies"
Hosts (14)
Reactivities (14), (12), (12), (12), (12)
Applications (10), (5), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Beacon