Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406305

Chromosome 1 Open Reading Frame 177 (C1ORF177) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406305
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf177 antibody: synthetic peptide directed towards the middle region of human C1orf177
Sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPK TPTERIYWAN
Predicted Reactivity Rabbit : 92%, Bovine : 85%, Horse : 85%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against C1orf177. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf177
Background The specific function of C1orf177 is not yet known.
Molecular Weight 47kDa
Gene ID 163747
NCBI Accession NP_689820, NM_152607
UniProt Q3ZCV2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf177 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Chromosome 1 Open Reading Frame 177 (C1ORF177)", type "Antibodies"
Hosts (26)
Reactivities (25), (24), (24), (12)
Applications (20), (8), (7), (6)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (1)
Beacon