Chromosome 1 Open Reading Frame 177 (C1ORF177) (Middle Region) antibody

Details for Product No. ABIN406305
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(26), (24), (24), (12)
Host
Rabbit
(26), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(20), (9), (6), (6), (1)
Pubmed 1 reference available
Catalog no. ABIN406305
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C1orf177
Sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPK TPTERIYWAN
Predicted Reactivity Rabbit : 92 %, Bovine : 82 %, Horse : 82 %, Dog : 72 %
Characteristics This is a rabbit polyclonal antibody against C1orf177. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C1orf177
Background The specific function of C1orf177 is not yet known.
Molecular Weight 47 kDa
Gene ID 163747
NCBI Accession NM_152607, NP_689820
UniProt Q3ZCV2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 414 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 1 Open Reading Frame 177 (C1ORF177) (Middle Region) antibody WB Suggested Anti-C1orf177 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (26), (1)
Reactivities (26), (24), (24), (12)
Applications (20), (9), (6), (6), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top