3-hydroxyisobutyrate Dehydrogenase (HIBADH) (Middle Region) antibody

Details for Product No. ABIN406312
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NS5ATP1, 6430402H10Rik, AI265272, hibadh, zgc:66262
Epitope
Middle Region
(4), (3), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(37), (13), (12), (1), (1), (1), (1)
Host
Rabbit
(38), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (14), (10), (10), (8), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406312
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HIBADH
Sequence WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQD SATSTKSPIL
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, African clawed frog : 90 %, Chicken : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against HIBADH. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HIBADH
Background 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.
Molecular Weight 35 kDa
Gene ID 11112
NCBI Accession NM_152740, NP_689953
UniProt P31937
Research Area Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 336 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-3-hydroxyisobutyrate Dehydrogenase (HIBADH) (Middle Region) antibody WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
Background publications Hughes, Frutiger, Paquet et al.: "Human liver protein map: update 1993." in: Electrophoresis, Vol. 14, Issue 11, pp. 1216-22, 1994 (PubMed).

Hosts (38), (1)
Reactivities (37), (13), (12), (1), (1), (1), (1)
Applications (21), (14), (10), (10), (8), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top