Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406318

KLRAQ Motif Containing 1 (KLRAQ1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110018J12Rik, AI426045, AW550781, Ccdc128, Klraq1, CCDC128, KLRAQ1, ccdc128, klraq1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406318
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCDC128 antibody: synthetic peptide directed towards the N terminal of human CCDC128
Sequence KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDE DLQKKIEENE
Predicted Reactivity Bovine :100%,   Human :100%,   African clawed frog :100%,   Dog :100%,   Mouse :100%,   Chicken :92%,   Green puffer :84%,   Zebrafish :78%,   Eubacterium ventriosum ATCC 27560 :76%,  
Characteristics This is a rabbit polyclonal antibody against CCDC128. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCDC128
Background The exact functions of CCDC128 remain unknown.
Molecular Weight 87kDa
Gene ID 129285
NCBI Accession NP_694539, NM_152994
UniProt Q6ZMI0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCDC128 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "KLRAQ Motif Containing 1 (KLRAQ1)", type "Antibodies"
Hosts (6)
Reactivities (5)
Applications (6), (3), (2), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon