KLRAQ Motif Containing 1 (KLRAQ1) (N-Term) antibody

Details for Product No. ABIN406318
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1110018J12Rik, AI426045, AW550781, Ccdc128, Klraq1, CCDC128, KLRAQ1, ccdc128, klraq1
Epitope
N-Term
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(4)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406318
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CCDC128
Sequence KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDE DLQKKIEENE
Predicted Reactivity Bovine :100 %,   Human :100 %,   African clawed frog :100 %,   Dog :100 %,   Mouse :100 %,   Chicken :90 %,   Green puffer :80 %,   Zebrafish :70 %,   Eubacterium ventriosum ATCC 27560 :70 %,  
Characteristics This is a rabbit polyclonal antibody against CCDC128. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CCDC128
Background The exact functions of CCDC128 remain unknown.
Molecular Weight 87 kDa
Gene ID 129285
NCBI Accession NM_152994, NP_694539
UniProt Q6ZMI0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 769 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-KLRAQ Motif Containing 1 (KLRAQ1) (N-Term) antibody WB Suggested Anti-CCDC128 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (5)
Reactivities (4)
Applications (5), (2), (2), (1)
Epitopes (2), (1), (1)
back to top