Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1) (N-Term) antibody

Details for Product No. ABIN406364
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms P28, hp28, dJ423B22.5, zgc:171493, zgc:171595, 1700023A09Rik, AW049135
Epitope
N-Term
(5), (3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(18), (6), (4), (1), (1), (1), (1)
Host
Rabbit
(16), (4)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(19), (6), (5), (4), (2)
Pubmed 1 reference available
Catalog no. ABIN406364
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DNALI1
Sequence MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVS RNTEKRSPKA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Mouse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against DNALI1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DNALI1
Background DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects.
Molecular Weight 31 kDa
Gene ID 7802
NCBI Accession NM_003462, NP_003453
UniProt O14645
Research Area Signaling, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 280 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dynein, Axonemal, Light Intermediate Chain 1 (DNALI1) (N-Term) antibody WB Suggested Anti-DNALI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Background publications Combs, Kim, Tan et al.: "Recruitment of dynein to the Jurkat immunological synapse." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 40, pp. 14883-8, 2006 (PubMed).

Hosts (16), (4)
Reactivities (18), (6), (4), (1), (1), (1), (1)
Applications (19), (6), (5), (4), (2)
Epitopes (5), (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top