Aminomethyltransferase (AMT) (N-Term) antibody

Details for Product No. ABIN406388
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCE, NKH, GCST, GCVT, EG434437, wu:fc31f04, wu:fd44b12, wu:fd54h12, zgc:103483, zgc:109741, F16J13.200, F16J13_200, T7P1.13, T7P1_13
Epitope
N-Term
(4), (4), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
(10)
Host
Rabbit
(9), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (4), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406388
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human AMT
Sequence QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDF HLAHGGKMVA
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against AMT. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name AMT
Background The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase, MIM 238300), H protein (a lipoic acid-containing protein, MIM 238330), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase, MIM 238331). Glycine encephalopathy (GCE, MIM 605899) may be due to a defect in any one of these enzymes.
Molecular Weight 44 kDa
Gene ID 275
NCBI Accession NM_000481, NP_000472
UniProt P48728
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 403 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Aminomethyltransferase (AMT) (N-Term) antibody WB Suggested Anti-AMT Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung
Background publications Kure, Kato, Dinopoulos et al.: "Comprehensive mutation analysis of GLDC, AMT, and GCSH in nonketotic hyperglycinemia." in: Human mutation, Vol. 27, Issue 4, pp. 343-52, 2006 (PubMed).

Hosts (9), (3)
Reactivities (10)
Applications (11), (4), (3), (2), (2), (1), (1)
Epitopes (4), (4), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top