Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406388

Aminomethyltransferase (AMT) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GCE, NKH, GCST, GCVT, EG434437, wu:fc31f04, wu:fd44b12, wu:fd54h12, zgc:103483, zgc:109741, F16J13.200, F16J13_200, T7P1.13, T7P1_13
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406388
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-AMT antibody: synthetic peptide directed towards the N terminal of human AMT
Sequence QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDF HLAHGGKMVA
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against AMT. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name AMT
Background The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). Glycine encephalopathy (GCE) may be due to a defect in any one of these enzymes.The enzyme system for cleavage of glycine (glycine cleavage system, EC 2.1.2.10), which is confined to the mitochondria, is composed of 4 protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase, MIM 238300), H protein (a lipoic acid-containing protein, MIM 238330), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase, MIM 238331). Glycine encephalopathy (GCE, MIM 605899) may be due to a defect in any one of these enzymes.
Molecular Weight 44kDa
Gene ID 275
NCBI Accession NP_000472, NM_000481
UniProt P48728
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-AMT antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kure, Kato, Dinopoulos et al.: "Comprehensive mutation analysis of GLDC, AMT, and GCSH in nonketotic hyperglycinemia." in: Human mutation, Vol. 27, Issue 4, pp. 343-52, 2006 (PubMed).

Alternatives for antigen "Aminomethyltransferase (AMT)", type "Antibodies"
Hosts (6), (2)
Reactivities (7)
Applications (8), (3), (3), (2), (2), (1)
Epitopes (5), (2), (2), (1)
Beacon