Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406396

Tumor Suppressor Candidate 1 (TUSC1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2200001D17Rik, TSG-9, TSG9
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406396
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TUSC1 antibody: synthetic peptide directed towards the middle region of human TUSC1
Sequence DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPR PSGDKEEQPL
Predicted Reactivity Human : 100%, Bovine : 91%, Mouse : 91%, Pig : 91%
Characteristics This is a rabbit polyclonal antibody against TUSC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TUSC1
Background Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.
Molecular Weight 23kDa
Gene ID 286319
NCBI Accession NP_001004125, NM_001004125
UniProt Q2TAM9
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TUSC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Shan, Parker, Wiest: "Identifying novel homozygous deletions by microsatellite analysis and characterization of tumor suppressor candidate 1 gene, TUSC1, on chromosome 9p in human lung cancer." in: Oncogene, Vol. 23, Issue 39, pp. 6612-20, 2004 (PubMed).

Alternatives for antigen "Tumor Suppressor Candidate 1 (TUSC1)", type "Antibodies"
Hosts (17)
Reactivities (15), (13), (12), (12)
Applications (10), (8), (4), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1), (1)
Beacon