Did you know that you can buy products from over 140 different suppliers from us?

Tumor Suppressor Candidate 1 (TUSC1) (Middle Region) antibody

Details for Product No. ABIN406396
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2200001D17Rik, TSG-9, TSG9
Epitope
Middle Region
(7), (7), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Human
(20), (13), (12), (12)
Host
Rabbit
(22)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (9), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406396
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TUSC1
Sequence DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPR PSGDKEEQPL
Predicted Reactivity Human : 100 %, Bovine : 90 %, Mouse : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against TUSC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TUSC1
Background Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.
Molecular Weight 23 kDa
Gene ID 286319
NCBI Accession NM_001004125, NP_001004125
UniProt Q2TAM9
Research Area Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 212 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tumor Suppressor Candidate 1 (TUSC1) (Middle Region) antibody WB Suggested Anti-TUSC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Background publications Shan, Parker, Wiest: "Identifying novel homozygous deletions by microsatellite analysis and characterization of tumor suppressor candidate 1 gene, TUSC1, on chromosome 9p in human lung cancer." in: Oncogene, Vol. 23, Issue 39, pp. 6612-20, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406396
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top