TUSC1 antibody (Middle Region)

Catalog No. ABIN631164

Product Details anti-TUSC1 Antibody

Target: TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))

Binding Specificity: Middle Region

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TUSC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TUSC1 antibody was raised against the middle region of TUSC1

Purification: Affinity purified

Immunogen: TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TUSC1 Blocking Peptide, catalog no. 33R-2164, is also available for use as a blocking control in assays to test for specificity of this TUSC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUSC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TUSC1

Target: TUSC1 (Tumor Suppressor Candidate 1 (TUSC1))

Alternative Name: TUSC1 (TUSC1 Products)

Synonyms: TSG-9 antibody, TSG9 antibody, 2200001D17Rik antibody, tumor suppressor candidate 1 antibody, TUSC1 antibody, Tusc1 antibody

Background: Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Molecular Weight: 23 kDa (MW of target protein)