Tumor Suppressor Candidate 1 (TUSC1) antibody

Antigen: Tumor Suppressor Candidate 1 (TUSC1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus), Mouse (Murine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN406396

Additional Information

Alternative name: TUSC1

Gene ID: TUSC1

Immunogen: The immunogen for anti-TUSC1 antibody: synthetic peptide directed towards the middle region of human TUSC1

Sequence: DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPR PSGDKEEQPL

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TUSC1 antibody concentration is 1 mg/ml.

Description: Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.

Characteristics: Antigen Size: 212 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-TUSC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Cancer

Restrictions: For Research Use only

Images

WB Suggested Anti-TUSC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Publications

Product: Shan, Parker, Wiest: "Identifying novel homozygous deletions by microsatellite analysis and characterization of tumor suppressor candidate 1 gene, TUSC1, on chromosome 9p in human lung cancer." in: Oncogene, Vol. 23, Issue 39, pp. 6612-20, 2004 (PubMed).