Chromosome 18 Open Reading Frame 10 (C18orf10) (Middle Region) antibody

Details for Product No. ABIN406491
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C18orf10, L17, PGs2, CZH18orf10, c18orf10, 5730437P09Rik, 5730494M16Rik, AI666318, Pgs2, RGD1310571, DKFZp468A177
Epitope
Middle Region
(2), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(8), (2), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(9), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406491
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C18orf10
Sequence SMYSLPNAPTLADLEDDTHEASDDQPEKPHFDSRSVIFEL DSCNGSGKVC
Predicted Reactivity Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against C18orf10. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C18orf10
Background The function of C18orf10 remains unknown.
Molecular Weight 33 kDa
Gene ID 25941
NCBI Accession NM_015476, NP_056291
UniProt Q68CL5
Research Area Signaling, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 300 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 18 Open Reading Frame 10 (C18orf10) (Middle Region) antibody WB Suggested Anti-C18orf10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Background publications Petroziello, Yamane, Westendorf et al.: "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer." in: Oncogene, Vol. 23, Issue 46, pp. 7734-45, 2004 (PubMed).

Hosts (9), (2)
Reactivities (8), (2), (1), (1), (1), (1), (1), (1)
Applications (11), (2), (2), (1)
Epitopes (2), (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top