Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406543

Chromosome 4 Open Reading Frame 22 (C4orf22) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406543
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C4orf22 antibody: synthetic peptide directed towards the N terminal of human C4orf22
Sequence YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARL AERAQQKTLT
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against C4orf22. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C4orf22
Background The specific function of C4orf22 is not yet known.
Molecular Weight 27kDa
Gene ID 255119
NCBI Accession NP_689983, NM_152770
UniProt Q6V702
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C4orf22 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Chromosome 4 Open Reading Frame 22 (C4orf22)", type "Antibodies"
Hosts (15), (1)
Reactivities (15), (12), (12), (12), (12)
Applications (10), (7), (5), (5)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2)
Beacon