Chromosome 4 Open Reading Frame 22 (C4orf22) (N-Term) antibody

Details for Product No. ABIN406543
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human
(15), (12), (12), (12), (12)
Host
Rabbit
(14), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN406543
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human C4orf22
Sequence YLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARL AERAQQKTLT
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against C4orf22. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C4orf22
Background The specific function of C4orf22 is not yet known.
Molecular Weight 27 kDa
Gene ID 255119
NCBI Accession NM_152770, NP_689983
UniProt Q6V702
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 233 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 4 Open Reading Frame 22 (C4orf22) (N-Term) antibody WB Suggested Anti-C4orf22 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Hosts (14), (2)
Reactivities (15), (12), (12), (12), (12)
Applications (10), (7), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
back to top