Did you know that you can buy products from over 140 different suppliers from us?

MGC45491 (Middle Region) antibody

Details for Product No. ABIN406550
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
Middle Region
Reactivity
Human
Host
Rabbit
Clonality
Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406550
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MGC45491
Sequence CRPLRPLLGFRESDSAKPASLRLLQHTPSARRNYRIAGAR LMRSNYPPPL
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against MGC45491. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Background The exact function of MGC45491 remains unknown.
Molecular Weight 26 kDa
Gene ID 221416
NCBI Accession NM_153246, NP_694978
UniProt Q8N319
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 242 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MGC45491 (Middle Region) antibody WB Suggested Anti-MGC45491 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Validation Images
back to top