Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406565

Tripartite Motif Family-Like 2 (TRIML2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SPRYD6, RGD1565382, Tu4, EG622117
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406565
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIML2 antibody: synthetic peptide directed towards the middle region of human TRIML2
Sequence TEMSLIYNFSHCAFQGALRPVFSLCIPNGDTSPDSLTILQ HGPSCDATVS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against TRIML2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIML2
Background The specific function of TRIML2 is not yet known.
Molecular Weight 44kDa
Gene ID 205860
NCBI Accession NP_775824, NM_173553
UniProt Q8N7C3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIML2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Tripartite Motif Family-Like 2 (TRIML2)", type "Antibodies"
Hosts (5)
Reactivities (3)
Applications (5), (1)
Epitopes (2), (1)
Beacon