Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406621

Lactamase, beta 2 (LACTB2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cgi-83, E430032H21Rik, lactb2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406621
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LACTB2 antibody: synthetic peptide directed towards the middle region of human LACTB2
Sequence NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHT DDHMALLLEE
Predicted Reactivity Chicken : 100%, Guinea pig : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against LACTB2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LACTB2
Background The specific function of LACTB2 is not yet known.
Molecular Weight 33kDa
Gene ID 51110
NCBI Accession NP_057111, NM_016027
UniProt Q53H82
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LACTB2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Lactamase, beta 2 (LACTB2)", type "Antibodies"
Hosts (16), (10)
Reactivities (26), (14), (14), (12), (1), (1)
Applications (17), (10), (9), (6), (5), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (1)
Beacon