Did you know that you can buy products from over 140 different suppliers from us?

Lactamase, beta 2 (LACTB2) (Middle Region) antibody

Details for Product No. ABIN406621
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Cgi-83, E430032H21Rik, lactb2
Epitope
Middle Region
(12), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(27), (14), (14), (12), (1), (1)
Host
Rabbit
(17), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (10), (9), (6), (5), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406621
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LACTB2
Sequence NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHT DDHMALLLEE
Predicted Reactivity Chicken : 100 %, Guinea pig : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against LACTB2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LACTB2
Background The specific function of LACTB2 is not yet known.
Molecular Weight 33 kDa
Gene ID 51110
NCBI Accession NM_016027, NP_057111
UniProt Q53H82
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 288 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lactamase, beta 2 (LACTB2) (Middle Region) antibody WB Suggested Anti-LACTB2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Validation Images
back to top