Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406655

Zinc Finger Protein 334 (ZNF334) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406655
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF334 antibody: synthetic peptide directed towards the N terminal of human ZNF334
Sequence KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLE NYSNLVSVGY
Predicted Reactivity Sumatran orangutan :100%,   Rat :78%,   Mouse :78%,   Dog :78%,   Sheep :78%,   Bovine :78%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZNF334. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF334
Background ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.
Molecular Weight 80kDa
Gene ID 55713
NCBI Accession NP_060572, NM_018102
UniProt Q9HCZ1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF334 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Alternatives for antigen "Zinc Finger Protein 334 (ZNF334)", type "Antibodies"
Hosts (4)
Reactivities (4)
Applications (4), (1)
Epitopes (1)
Beacon