Zinc Finger Protein 334 (ZNF334) (N-Term) antibody

Details for Product No. ABIN406655
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(4)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4)
Pubmed 1 reference available
Catalog no. ABIN406655
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF334
Sequence KMKKFQIPVSFQDLTVNFTQEEWQQLDPAQRLLYRDVMLE NYSNLVSVGY
Predicted Reactivity Sumatran orangutan :100 %,   Rat :70 %,   Mouse :70 %,   Dog :70 %,   Sheep :70 %,   Bovine :70 %,   Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF334. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF334
Background ZNF334 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 14 C2H2-type zinc fingers and 1 KRAB domain. ZNF334 may be involved in transcriptional regulation.
Molecular Weight 80 kDa
Gene ID 55713
NCBI Accession NM_018102, NP_060572
UniProt Q9HCZ1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 680 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 334 (ZNF334) (N-Term) antibody WB Suggested Anti-ZNF334 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Hosts (4)
Reactivities (4)
Applications (4)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top