SMT3 Suppressor of Mif Two 3 Homolog 3 (S. Cerevisiae) (SUMO3) antibody

Antigen: SMT3 Suppressor of Mif Two 3 Homolog 3 (S. Cerevisiae) (SUMO3)

Synonyms: SMT3A, SMT3H1, SUMO-3, Smt3h1, AA409334, AW121497, AW536077, D10Ertd345e, 2810014B19Rik, sumo3, sumo2, fa94a11, zgc:65847, zgc:85643, im:7141764, wu:fa94a11, wu:fb55d09, fc66f10, fl11h12, zgc:86902, wu:fc66f10, wu:fl11h12, SUMO3, ATSUMO3, MCO15.12, MCO15_12, SMALL UBIQUITIN-LIKE MODIFIER 3, SUM3, SUMO 3

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN406672

Additional Information

Alternative name: SUMO3 / SMT3A

Gene ID: SUMO3

UniProt: P55854

Immunogen: The immunogen for anti-SUMO3 antibody: synthetic peptide directed towards the middle region of human SUMO3

Sequence: MRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGV PESSLAGHSF

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SUMO3 antibody concentration is 1 mg/ml.

Description: SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability.SUMO proteins, such as SUMO3, and ubiquitin (see MIM 191339) posttranslationally modify numerous cellular proteins and affect their metabolism and function. However, unlike ubiquitination, which targets proteins for degradation, sumoylation participates in a number of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability (Su and Li, 2002 [PubMed 12383504]).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 103 amino acids

Molecular Weight: 12kDa

Synonyms: SMT3A, SMT3H1, SUMO-3, Smt3h1, AA409334, AW121497, AW536077, D10Ertd345e, 2810014B19Rik, sumo3, sumo2, fa94a11, zgc:65847, zgc:85643, im:7141764, wu:fa94a11, wu:fb55d09, fc66f10, fl11h12, zgc:86902, wu:fc66f10, wu:fl11h12, SUMO3, ATSUMO3, MCO15.12, MCO15_12, SMALL UBIQUITIN-LIKE MODIFIER 3, SUM3, SUMO 3

Application Details

Application Notes: WB Suggested Anti-SUMO3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SUMO3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate

Publications

Product: Zhang, Goeres, Zhang et al.: "SUMO-2/3 modification and binding regulate the association of CENP-E with kinetochores and progression through mitosis." in: Molecular cell, Vol. 29, Issue 6, pp. 729-41, 2008 (PubMed).