Did you know that you can buy products from over 140 different suppliers from us?

Nuclear Transcription Factor, X-Box Binding 1 (NFX1) (Middle Region) antibody

Details for Product No. ABIN406763
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NFX1, NFX2, 1300017N15Rik, 3000003M19Rik, NFX.1, TEG-42, Tex42
Epitope
Middle Region
(7), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine)
(31), (15), (15), (1), (1)
Host
Rabbit
(21), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(21), (11), (10), (6), (4), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406763
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NFX1
Sequence TLTGVLEREMQARPPPPIPHHRHQSDKNPGSSNLQKITKE PIIDYFDVQD
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Predicted Reactivity Human : 100 %, Bovine : 80 %, Dog : 80 %, Rabbit : 80 %, Rat : 80 %, Mouse : 70 %
Purification Affinity Purified
Alternative Name NFX1
Background MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. NFX1 is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma.MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. The protein encoded by this gene is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma. Three alternative splice variants, each of which encodes a different isoform, have been identified.
Molecular Weight 124 kDa
NCBI Accession NM_002504, NP_002495
UniProt Q12986
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Proteolysis / Ubiquitin, Adaptive Immunity
Application Notes WB Suggested Anti-NFX1 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1120 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Nuclear Transcription Factor, X-Box Binding 1 (NFX1) (Middle Region) antibody WB Suggested Anti-NFX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
anti-Nuclear Transcription Factor, X-Box Binding 1 (NFX1) (Middle Region) antibody (2) anti-Nuclear Transcription Factor, X-Box Binding 1 (NFX1) (Middle Region) antibody (Image 2)
Background publications Katzenellenbogen, Egelkrout, Vliet-Gregg et al.: "NFX1-123 and poly(A) binding proteins synergistically augment activation of telomerase in human papillomavirus type 16 E6-expressing cells." in: Journal of virology, Vol. 81, Issue 8, pp. 3786-96, 2007 (PubMed).

Validation Images
back to top