Did you know that you can buy products from over 140 different suppliers from us?

Engrailed 1 (EN1) (C-Term) antibody

Details for Product No. ABIN406781
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms En-1, Mo-en.1, en-1, en1, en1-A, eng1, engrailed-1, xen1
Epitope
C-Term
(3), (2), (1), (1), (1), (1)
Reactivity
Chicken, Human, Mouse (Murine), Zebrafish, Xenopus laevis
(23), (14), (12), (12), (12), (12), (12)
Host
Rabbit
(18), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (9), (9), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406781
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human EN1
Sequence LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRT RKLKKKKNEK
Cross-Reactivity Chicken, Human, Mouse (Murine)
Predicted Reactivity Guinea pig : 93 %, Pig : 93 %, African clawed frog : 93 %, Rabbit : 83 %
Purification Affinity Purified
Alternative Name Engrailed-1 / EN1
Background Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.
Molecular Weight 40 kDa
NCBI Accession NM_001426, NP_001417
UniProt Q05925
Application Notes WB Suggested Anti-EN1 Antibody Titration: 0.2-1 µg/mL
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 392 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Engrailed 1 (EN1) (C-Term) antibody WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Atit, Sgaier, Mohamed et al.: "Beta-catenin activation is necessary and sufficient to specify the dorsal dermal fate in the mouse." in: Developmental biology, Vol. 296, Issue 1, pp. 164-76, 2006 (PubMed).

Validation Images
back to top