Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) antibody

Antigen

Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8)
Synonyms CSA, CKN1
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human
Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN486848
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) antibody

anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) antibody (2)

anti-Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8) antibody (3)

Additional Information
Application Details Publications Images Alternatives Variants back to top

Alternative name ERCC8
Gene ID ERCC8
Immunogen The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8
Sequence QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFE DAWSSSDEEG
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ERCC8 antibody concentration is 1 mg/ml.
Description ERCC8 (excision repair cross-complementing rodent repair deficiency, complementation group 8 isoform 1) is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcript
Characteristics Antigen Size: 396 amino acids
Molecular Weight 44kDa

Application Details
Publications Images Alternatives Variants back to top

Application Notes WB Suggested Anti-ERCC8 Antibody Titration: 0.1-5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only

Publications
Application Details Images Alternatives Variants back to top

Product Groisman, Polanowska, Kuraoka et al.: "The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage." in: Cell, Vol. 113, Issue 3, pp. 357-67, 2003 (PubMed).

Alternatives
Application Details Publications Images Variants back to top

Alternatives for antigen "Excision Repair Cross-Complementing Rodent Repair Deficiency, Complementation Group 8 (ERCC8)", type "Antibodies"
Hosts Rabbit (19), Mouse (4)
Reactivities Human (22), Mouse (Murine) (5), Dog (Canine) (3), Cow (Bovine) (2), Chicken (1), Rat (Rattus) (1), Zebrafish (1)
Applications Western Blotting (WB) (20), ELISA (5), Immunocytochemistry (ICC) (5), Immunofluorescence (IF) (5), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Dot Blot (DB) (1), Dot Blot (Dot) (1), Immunohistochemistry (IHC) (1)
Epitopes Internal Region (3), Center (2), N-Term (2)