Did you know that you can buy products from over 140 different suppliers from us?

Dehydrogenase/reductase (SDR Family) X-Linked (DHRSX) (C-Term) antibody

Details for Product No. ABIN486864
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DHRSY, DHRS5X, DHRS5Y, DHRSXY, CXorf11, SDR46C1, MGC85576, MGC137901
Epitope
C-Term
(2), (2), (2)
Reactivity
Human
(19)
Host
Rabbit
(17), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (3), (3), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN486864
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human DHRSX
Sequence DEGAWTSIYAAVTPELEGVGGHYLYNEKETKSLHVTYNQK LQQQLWSKSC
Predicted Reactivity Dog : 100 %, Guinea pig : 90 %, Human : 90 %
Characteristics This is a rabbit polyclonal antibody against DHRSX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DHRSX
Background DHRSX belongs to the short-chain dehydrogenases/reductases (SDR) family. The exact function of DHRSX remains unknown.
Molecular Weight 36 kDa
Gene ID 207063
NCBI Accession NM_145177, NP_660160
UniProt Q8N5I4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 330 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Dehydrogenase/reductase (SDR Family) X-Linked (DHRSX) (C-Term) antibody WB Suggested Anti-DHRSX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
Background publications Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN486864
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top