Receptor-Interacting serine-threonine Kinase 3 (RIPK3) antibody

Antigen: Receptor-Interacting serine-threonine Kinase 3 (RIPK3)

Synonyms: RIP3, Hcyp2, RIPK3, MGC152488

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN486988

Additional Information

Alternative name: RIPK3 / RIP3

Gene ID: RIPK3

UniProt: Q9Y572

Immunogen: The immunogen for anti-RIPK3 antibody: synthetic peptide directed towards the N terminal of human RIPK3

Sequence: AQHRKWGYDVAVKIVNSKAISREVKAMASLDNEFVLRLEG VIEKVNWDQD

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RIPK3 antibody concentration is 1 mg/ml.

Description: RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 518 amino acids

Molecular Weight: 57kDa

Application Details

Application Notes: WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RIPK3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Publications

Product: Cerhan, Ansell, Fredericksen et al.: "Genetic variation in 1253 immune and inflammation genes and risk of non-Hodgkin lymphoma." in: Blood, Vol. 110, Issue 13, pp. 4455-63, 2007 (PubMed).