Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487025

Zinc Finger Protein 64 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF338, znf64, znf338
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487025
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFP64 antibody: synthetic peptide directed towards the N terminal of human ZFP64
Sequence YLPTESNENQTATVISLPAKSRTKKPTTPPAQKRLNCCYP GCQFKTAYGM
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Bovine : 92%, Guinea pig : 92%, Chicken : 90%, Mouse : 84%, Rat : 76%
Characteristics This is a rabbit polyclonal antibody against ZFP64. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZFP64
Background ZFP64 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. ZFP64 may be involved in transcriptional regulation.
Molecular Weight 72kDa
Gene ID 55734
NCBI Accession NP_955459, NM_199427
UniProt Q9NTW7
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFP64 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 64", type "Antibodies"
Hosts (16)
Reactivities (16), (5), (5), (4), (4), (3), (2)
Applications (15), (4), (1), (1)
Epitopes (5), (4), (2), (2), (2), (1), (1), (1)
Beacon