Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487044

Short Stature Homeobox 2 (SHOX2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms OG12, SHOT, OG12X, Prx3, Og12x, 6330543G17Rik, zgc:65884, zgc:77344, SHOX2, og12, shot, og12x, ogi2x
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487044
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SHOX2 antibody: synthetic peptide directed towards the N terminal of human SHOX2
Sequence EELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPT GCTEAGRDDR
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against SHOX2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SHOX2
Background SHOX2 is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is a member of the homeo box family of genes that encode proteins containing a 60-amino acid residue motif that represents a DNA binding domain. Homeo box genes have been characterized extensively as transcriptional regulators involved in pattern formation in both invertebrate and vertebrate species. Several human genetic disorders are caused by aberrations in human homeo box genes. SHOX is a pseudoautosomal homeo box gene that is thought to be responsible for idiopathic short stature and implicated to play a role in the short stature phenotype of Turner syndrome patients. This gene is considered to be a candidate gene for Cornelia de Lange syndrome. Alternative splicing has been observed at this locus and two variants, each encoding a distinct isoform, have been identified.
Molecular Weight 35kDa
Gene ID 6474
NCBI Accession NP_006875, NM_006884
UniProt O60902
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SHOX2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Hillman, Green, Brenner: "An unappreciated role for RNA surveillance." in: Genome biology, Vol. 5, Issue 2, pp. R8, 2004 (PubMed).

Alternatives for antigen "Short Stature Homeobox 2 (SHOX2)", type "Antibodies"
Hosts (9), (7)
Reactivities (16), (6), (4), (2), (2), (1)
Applications (15), (5), (3), (1), (1)
Epitopes (4), (3), (3), (3), (1), (1)
Beacon