Mediator Complex Subunit 27 (MED27) (Middle Region) antibody

Details for Product No. ABIN487113
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms
crsp8, zgc:66302, CRSP8, CRAP34, CRSP34, TRAP37, Crsp8, AA682045, D2Ertd434e, 1500015J03Rik, 2310042P07Rik, RGD1564993, CG1245, Dmel\\CG1245, Med27, Trap37, dCRSP34, dCrsp34, dTRAP37, med27, MED27, DD ... show more
crsp8, zgc:66302, CRSP8, CRAP34, CRSP34, TRAP37, Crsp8, AA682045, D2Ertd434e, 1500015J03Rik, 2310042P07Rik, RGD1564993, CG1245, Dmel\\CG1245, Med27, Trap37, dCRSP34, dCrsp34, dTRAP37, med27, MED27, DDBDRAFT_0216764, DDBDRAFT_0266847, DDB_0216764, DDB_0266847, DKFZp459I1912 show less
Epitope
Middle Region
(3), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis, Cow (Bovine), Dog (Canine), Human, Chicken
(15), (5), (1), (1), (1), (1), (1), (1), (1), (1)
Host
Rabbit
(9), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (7), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN487113
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human MED27
Sequence LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNE NVYTEDGKLD
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Human : 100 %, Pig : 100 %, Mouse : 90 %, Rat : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against MED27. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MED27
Background The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. MED27 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Molecular Weight 35 kDa
Gene ID 9442
NCBI Accession NM_004269, NP_004260
UniProt Q6P2C8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 311 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9...." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Hosts (9), (6)
Reactivities (15), (5), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (15), (7), (3), (1)
Epitopes (3), (3), (2), (1), (1)
back to top