Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487113

Mediator Complex Subunit 27 (MED27) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
crsp8, zgc:66302, CRSP8, CRAP34, CRSP34, TRAP37, Crsp8, AA682045, D2Ertd434e, 1500015J03Rik, 2310042P07Rik, RGD1564993, CG1245, Dmel\\CG1245, Med27, Trap37, dCRSP34, dCrsp34, dTRAP37, med27, MED27, DD ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Xenopus laevis, Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487113
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MED27 antibody: synthetic peptide directed towards the middle region of human MED27
Sequence LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNE NVYTEDGKLD
Predicted Reactivity Bovine : 100%, Chicken : 100%, Human : 100%, Pig : 100%, Mouse : 92%, Rat : 92%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against MED27. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MED27
Background The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. MED27 is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.
Molecular Weight 35kDa
Gene ID 9442
NCBI Accession NP_004260, NM_004269
UniProt Q6P2C8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MED27 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Mediator Complex Subunit 27 (MED27)", type "Antibodies"
Hosts (6), (6)
Reactivities (12), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (12), (5), (3), (1)
Epitopes (3), (2), (1), (1), (1)
Beacon