Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487119

Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EAAT2, GLT-1, GLT1, Eaat2, MGLT1, AI159670, 1700091C19Rik, 2900019G14Rik, Glt, Glt-1, eaat2, fj34b12, slc1a2, wu:fj34b12, zgc:65897, CG3159, Dmel\\CG3159, EAAT, dEAAT2, dEaat2, Eaat, GB16377, SLC1A2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN487119
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC1A2 antibody: synthetic peptide directed towards the N terminal of human SLC1A2
Sequence PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQA CFQQIQTVTK
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Zebrafish : 91%
Characteristics This is a rabbit polyclonal antibody against SLC1A2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC1A2
Background SLC1A2 is a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
Molecular Weight 62kDa
Gene ID 6506
NCBI Accession NP_004162, NM_004171
UniProt P43004
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC1A2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Solute Carrier Family 1 (Glial High Affinity Glutamate Transporter), Member 2 (SLC1A2)", type "Antibodies"
Hosts (36), (18), (3), (1)
Reactivities (43), (32), (24), (12), (1), (1), (1), (1), (1)
Applications (42), (17), (15), (10), (10), (5), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (5), (3), (3), (3), (2), (1), (1), (1), (1), (1)
Beacon