Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 83 (ZNF83) (N-Term) antibody

Details for Product No. ABIN487140
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HPF1, ZNF816B
Epitope
N-Term
(11), (7), (2), (1), (1), (1)
Reactivity
Human
(22), (1)
Host
Rabbit
(15), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (2), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487140
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF83
Sequence HGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYD HMEKSVNSSS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF83. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF83
Background ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.
Molecular Weight 60 kDa
Gene ID 55769
NCBI Accession NM_018300, NP_060770
UniProt Q6PI08
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 516 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 83 (ZNF83) (N-Term) antibody WB Suggested Anti-ZNF83 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487140
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top