Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 485 (ZNF485) (C-Term) antibody

Details for Product No. ABIN487145
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF485
Epitope
C-Term
(3), (2), (1)
Reactivity
Human
(9), (1)
Host
Rabbit
(9), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487145
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ZNF485
Sequence SSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHN KERAMKCS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF485. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF485
Background ZNF485 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF485 may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 220992
NCBI Accession NM_145312, NP_660355
UniProt Q8NCK3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 402 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 485 (ZNF485) (C-Term) antibody WB Suggested Anti-ZNF485 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487145
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top