Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487145

Zinc Finger Protein 485 (ZNF485) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF485
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487145
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF485 antibody: synthetic peptide directed towards the C terminal of human ZNF485
Sequence SSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHN KERAMKCS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF485. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF485
Background ZNF485 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF485 may be involved in transcriptional regulation.
Molecular Weight 46kDa
Gene ID 220992
NCBI Accession NP_660355, NM_145312
UniProt Q8NCK3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF485 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 485 (ZNF485)", type "Antibodies"
Hosts (9), (1)
Reactivities (9), (1)
Applications (9), (2), (1)
Epitopes (3), (2), (1)
Beacon