ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (ST6GALNAC3) antibody

Antigen: ST6 (Alpha-N-Acetyl-Neuraminyl-2,3-beta-Galactosyl-1,3)-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (ST6GALNAC3)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN487220

Additional Information

Alternative name: ST6GALNAC3

Gene ID: ST6GALNAC3

UniProt: Q8NDV1

Immunogen: The immunogen for anti-ST6GALNAC3 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC3

Sequence: HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKH RIIFTHPNWT

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ST6GALNAC3 antibody concentration is 1 mg/ml.

Description: ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).[supplied by OMIM].

Characteristics: Antigen Size: 305 amino acids

Molecular Weight: 35kDa

Application Details

Application Notes: WB Suggested Anti-ST6GALNAC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ST6GALNAC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).