Did you know that you can buy products from over 140 different suppliers from us?

alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) antibody

Details for Product No. ABIN487220
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms fb68h09, siat7c, st6GalNAc-III, wu:fb67c12, wu:fb68h09, zgc:73301, SIAT7C, PRO7177, ST6GALNACIII, STY, Siat7c
Epitope
C-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human, Chicken
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487220
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ST6GALNAC3
Sequence HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKH RIIFTHPNWT
Predicted Reactivity Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against ST6GALNAC3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ST6GALNAC3
Background ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids (Lee et al., 1999 [PubMed 10207017]).
Molecular Weight 35 kDa
Gene ID 256435
NCBI Accession NM_152996, NP_694541
UniProt Q8NDV1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 305 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) antibody WB Suggested Anti-ST6GALNAC3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Validation Images
back to top