Did you know that you can buy products from over 140 different suppliers from us?

Protocadherin alpha 4 (PCDHA4) (N-Term) antibody

Details for Product No. ABIN487225
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CNR1, CNRN1, CRNR1, PCDH-ALPHA4, Cnr1, Crnr1, R75250, PCDHA4, PCDHA7
Epitope
N-Term
(9), (8), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Dog (Canine), Xenopus laevis, Pig (Porcine), Cow (Bovine), Human
(30), (18), (18), (18), (18)
Host
Rabbit
(30), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (15), (14), (10), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487225
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PCDHA4
Sequence VDRPLQVFHVDVEVRDINDNPPVFPATQKNLSIAESRPLD SRFPLEGASD
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against PCDHA4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PCDHA4
Background The gene encoding PCDHA4 is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin alpha gene cluster, one of three related gene clusters tandemly linked on chromosome five that demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The alpha gene cluster is composed of 15 cadherin superfamily genes related to the mouse CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. The tandem array of 15 N-terminal exons, or variable exons, are followed by downstream C-terminal exons, or constant exons, which are shared by all genes in the cluster. The large, uninterrupted N-terminal exons each encode six cadherin ectodomains while the C-terminal exons encode the cytoplasmic domain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been observed and additional variants have been suggested but their full-length nature has yet to be determined.
Molecular Weight 99 kDa
Gene ID 56144
NCBI Accession NM_018907, NP_061730
UniProt Q9UN74
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 947 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protocadherin alpha 4 (PCDHA4) (N-Term) antibody WB Suggested Anti-PCDHA4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487225
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top