Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 17 Open Reading Frame 64 (C17orf64) (Middle Region) antibody

Details for Product No. ABIN487248
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C17orf64
Epitope
Middle Region
(1)
Reactivity
Human
(13), (12), (12), (12), (12), (12)
Host
Rabbit
(14)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (5), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487248
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C17orf64
Sequence NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRI KEAPETPETE
Predicted Reactivity Pig : 92 %, Rabbit : 92 %, Dog : 82 %
Characteristics This is a rabbit polyclonal antibody against C17orf64. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C17orf64
Background The function of this protein remains unknown.
Molecular Weight 14 kDa
Gene ID 124773
NCBI Accession NM_181707, NP_859058
UniProt Q86WR6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 126 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 17 Open Reading Frame 64 (C17orf64) (Middle Region) antibody WB Suggested Anti-C17orf64 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487248
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top