Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487248

Chromosome 17 Open Reading Frame 64 (C17orf64) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C17orf64
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487248
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C17orf64 antibody: synthetic peptide directed towards the middle region of human C17orf64
Sequence NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRI KEAPETPETE
Predicted Reactivity Pig : 92%, Rabbit : 91%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against C17orf64. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C17orf64
Background The function of this protein remains unknown.
Molecular Weight 14kDa
Gene ID 124773
NCBI Accession NP_859058, NM_181707
UniProt Q86WR6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C17orf64 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Chromosome 17 Open Reading Frame 64 (C17orf64)", type "Antibodies"
Hosts (15)
Reactivities (14), (12), (12), (12), (12), (12)
Applications (10), (6), (5), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon