Fas Apoptotic Inhibitory Molecule (FAIM) (Middle Region) antibody

Details for Product No. ABIN487272
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms FAIM1, EG623459, FAIM, faim
Epitope
Middle Region
(8), (6), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(41), (29), (21), (15), (12), (11), (11), (1), (1)
Host
Rabbit
(37), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(34), (18), (9), (8), (4)
Pubmed 1 reference available
Catalog no. ABIN487272
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FAIM
Sequence FRIVLEKDAMDVWCNGKKLETAGEFVDDGTETHFSIGNHD CYIKAVSSGK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %, Dog : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against FAIM. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAIM
Background FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
Molecular Weight 24 kDa
Gene ID 55179
NCBI Accession NM_001033030, NP_001028202
UniProt Q9NVQ4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 213 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Fas Apoptotic Inhibitory Molecule (FAIM) (Middle Region) antibody WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: OVCAR-3 cell lysate
Background publications Segura, Sole, Pascual et al.: "The long form of Fas apoptotic inhibitory molecule is expressed specifically in neurons and protects them against death receptor-triggered apoptosis." in: The Journal of neuroscience : the official journal of the Society for Neuroscience, Vol. 27, Issue 42, pp. 11228-41, 2007 (PubMed).

Hosts (37), (7)
Reactivities (41), (29), (21), (15), (12), (11), (11), (1), (1)
Applications (34), (18), (9), (8), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (6), (2), (2), (1), (1)
back to top