Homeobox Protein OTX1 (C-Term) antibody

Details for Product No. ABIN487303
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms jv, A730044F23Rik, OTX1X, otx1, cb769, zOtx1, fj99f05, wu:fj99f05, otx1-A, xotx1
Epitope
C-Term
(4), (3), (3), (2), (2), (1), (1)
Reactivity
Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Xenopus laevis, Dog (Canine), Chicken, Rabbit
(30), (17), (17), (16), (16), (12), (1), (1), (1), (1)
Host
Rabbit
(27), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (8), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN487303
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human OTX1
Sequence SGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQ ASWRFQVL
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics Antigen Size: 354 amino acids
Purification Affinity Purified
Alternative Name OTX1
Background OTX1 is a member of the bicoid sub-family of homeodomain-containing transcription factors. OTX1 acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper brain and sensory organ development and can cause epilepsy.
Molecular Weight 37 kDa
NCBI Accession NM_014562, NP_055377
UniProt P32242
Application Notes WB Suggested Anti-OTX1 Antibody Titration: 0.2-1 µg/mL
Positive Control: Transfected 293T.
Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 354 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage 4 °C
Storage Comment Any unfrozen and/or unused material can be stored at 4 °C for short term use (< 1 week), and should not be re-frozen. For longer periods of storage, store at -24 °C
Supplier Images
anti-Homeobox Protein OTX1 (C-Term) antibody WB Suggested Anti-OTX1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (27), (4)
Reactivities (30), (17), (17), (16), (16), (12), (1), (1), (1), (1)
Applications (19), (10), (8), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (3), (2), (2), (1), (1)
back to top