ABCB10 antibody (C-Term)
-
- Target See all ABCB10 Antibodies
- ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))
-
Binding Specificity
- AA 640-678, C-Term
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ABCB10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human,Rat.
- Sequence
- QRIAIARALL KNPKILLLDE ATSALDAENE YLVQEALDR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for ATP-binding cassette sub-family B member 10, mitochondrial(ABCB10) detection. Tested with WB in Human,Rat.
Gene Name: ATP binding cassette subfamily B member 10
Protein Name: ATP-binding cassette sub-family B member 10, mitochondrial - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human ABCB10 (640-678aa QRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDR), different from the related mouse sequence by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product ABCB10 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- ABCB10 (ATP-Binding Cassette, Sub-Family B (MDR/TAP), Member 10 (ABCB10))
- Alternative Name
- ABCB10 (ABCB10 Products)
- Synonyms
- EST20237 antibody, M-ABC2 antibody, MTABC2 antibody, Abc-me antibody, Abcb12 antibody, ABCB10 antibody, si:dkey-162b3.3 antibody, GB10581 antibody, ATP binding cassette subfamily B member 10 antibody, ATP-binding cassette, sub-family B (MDR/TAP), member 10 antibody, ATP-binding cassette sub-family B member 10, mitochondrial antibody, ABCB10 antibody, Abcb10 antibody, abcb10 antibody, LOC552744 antibody
- Background
-
ABCB10, also known as M-ABC2, is expressed as a 60-kD nonglycosylated mitochondrial membrane protein. This ABCB10 gene is mapped to 1q42.13. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The function of this mitochondrial protein is unknown.
Synonyms: ABC transporter 10 protein | ABCB10 | EST20237 | M ABC2 | M-ABC2 | MTABC2 | Q9NRK6 - Gene ID
- 23456
-