EPHX2 antibody (C-Term)
-
- Target See all EPHX2 Antibodies
- EPHX2 (Epoxide Hydrolase 2, Cytoplasmic (EPHX2))
-
Binding Specificity
- AA 505-543, C-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EPHX2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Tested with WB in Human,Mouse,Rat.
- Sequence
- QHMEDWIPHL KRGHIEDCGH WTQMDKPTEV NQILIKWLD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: epoxide hydrolase 2
Protein Name: Bifunctional epoxide hydrolase 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product EPHX2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- EPHX2 (Epoxide Hydrolase 2, Cytoplasmic (EPHX2))
- Alternative Name
- EPHX2 (EPHX2 Products)
- Synonyms
- CEH antibody, SEH antibody, Eph2 antibody, sEP antibody, epoxide hydrolase 2 antibody, soluble epoxide hydrolase antibody, Soluble epoxide hydrolase antibody, alpha/beta hydrolase antibody, epoxide hydrolase 2, cytoplasmic antibody, EPHX2 antibody, SEH2 antibody, PTRG_01276 antibody, Deima_0402 antibody, Deipr_0144 antibody, Psed_0418 antibody, Fluta_3767 antibody, HALXA_RS12710 antibody, Ephx2 antibody
- Background
-
Soluble epoxide hydrolase (sEH) is a bifunctional enzyme that in humans is encoded by the EPHX2 gene. It is mapped to 8p21.2-p21.1. This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
Synonyms: CEH | EPHX2 | SEH | P34913 - Gene ID
- 2053
- UniProt
- P34913
-